PDB entry 2f0r

View 2f0r on RCSB PDB site
Description: Crystallographic structure of human Tsg101 UEV domain
Class: unknown function
Keywords: Tsg101, UNKNOWN FUNCTION
Deposited on 2005-11-13, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.191
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f0ra_
  • Chain 'B':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f0rb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f0rA (A:)
    mrgshhhhhhgmasmavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfnd
    gssrelmnltgtipvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdan
    gkiylpylhewkhpqsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0rA (A:)
    vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
    yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
    dllgliqvmivvfgdeppvfsrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f0rB (B:)
    mrgshhhhhhgmasmavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfnd
    gssrelmnltgtipvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdan
    gkiylpylhewkhpqsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0rB (B:)
    vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
    yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
    dllgliqvmivvfgdeppvfsrp