PDB entry 2f0g

View 2f0g on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease mutant V66I
Class: hydrolase
Keywords: DNA hydrolase; RNA hydrolase; endonuclease; calcium; signal
Deposited on 2005-11-13, released 2006-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (65)
      • variant (123)
    Domains in SCOPe 2.06: d2f0ga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f0gA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmienakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0gA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmi
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
    kseaqakkeklniws