PDB entry 2f0c

View 2f0c on RCSB PDB site
Description: Structure of the Receptor Binding Protein (ORF49, bbp) from lactophage tp901-1
Class: viral protein
Keywords: Beta-barrel, beta prism, 3 helix parallel bundle, VIRAL PROTEIN
Deposited on 2005-11-13, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.158
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phage tp901-1 ORF49 (BPP)
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF49/bbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f0ca1, d2f0ca2
  • Chain 'B':
    Compound: Phage tp901-1 ORF49 (BPP)
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF49/bbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f0cb1, d2f0cb2
  • Chain 'C':
    Compound: Phage tp901-1 ORF49 (BPP)
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF49/bbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f0cc1, d2f0cc2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f0cA (A:)
    msyyhhhhhhlestslykkagsenlyfqgasikkvyrgmkngaetinddleainseltsg
    gnvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysigg
    eisssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptassg
    tprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0cA (A:)
    tinddleainseltsggnvvhktgdetiagkktftgnvevngsltlptkswsgelgggii
    lslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvghmvggwnafhidi
    pssgvcqwfgptassgtprgtgtypid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f0cB (B:)
    msyyhhhhhhlestslykkagsenlyfqgasikkvyrgmkngaetinddleainseltsg
    gnvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysigg
    eisssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptassg
    tprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0cB (B:)
    etinddleainseltsggnvvhktgdetiagkktftgnvevngsltlptkswsgelgggi
    ilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvghmvggwnafhid
    ipssgvcqwfgptassgtprgtgtypid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f0cC (C:)
    msyyhhhhhhlestslykkagsenlyfqgasikkvyrgmkngaetinddleainseltsg
    gnvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysigg
    eisssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptassg
    tprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0cC (C:)
    tinddleainseltsggnvvhktgdetiagkktftgnvevngsltlptkswsgelgggii
    lslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvghmvggwnafhidi
    pssgvcqwfgptassgtprgtgtypid