PDB entry 2f09

View 2f09 on RCSB PDB site
Description: Solution Structure of the gene product of E. coli gene ydhA
Class: structural genomics, unknown function
Keywords: 8 strand beta-barrel, Structural Genomics, Ontario Centre for Structural Proteomics, OCSP, UNKNOWN FUNCTION
Deposited on 2005-11-12, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ydhA
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ydhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2f09a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f09A (A:)
    mgsshhhhhhssglvprgshmqtdtleyqcdekpltvklnnprqevsfvydnqllhlkqg
    isasgarytdgiyvfwskgdeatvykrdrivlnncqlqnpqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f09A (A:)
    mqtdtleyqcdekpltvklnnprqevsfvydnqllhlkqgisasgarytdgiyvfwskgd
    eatvykrdrivlnncqlqnpqr