PDB entry 2f08

View 2f08 on RCSB PDB site
Description: Crystal structure of a major house dust mite allergen, Derf 2
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2005-11-12, released 2005-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mite allergen Der f II
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f08a_
  • Chain 'B':
    Compound: mite allergen Der f II
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f08b_
  • Chain 'C':
    Compound: mite allergen Der f II
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f08c_
  • Chain 'D':
    Compound: mite allergen Der f II
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f08d_
  • Heterogens: P4C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f08A (A:)
    dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
    leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
    iathgkird
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f08B (B:)
    dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
    leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
    iathgkird
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f08C (C:)
    dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
    leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
    iathgkird
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f08D (D:)
    dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
    leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
    iathgkird