PDB entry 2f06

View 2f06 on RCSB PDB site
Description: Crystal structure of protein BT0572 from Bacteroides thetaiotaomicron
Class: structural genomics, unknown function
Keywords: structural genomics Hypothetical protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-11-11, released 2005-12-27
The last revision prior to the SCOP 1.75 freeze date was dated 2007-12-04, with a file datestamp of 2007-11-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Bacteroides thetaiotaomicron VPI-5482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AA93 (3-143)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (102)
      • modified residue (120)
    Domains in SCOP 1.75: d2f06a1, d2f06a2
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Bacteroides thetaiotaomicron VPI-5482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AA93 (3-143)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (102)
      • modified residue (120)
    Domains in SCOP 1.75: d2f06b1, d2f06b2
  • Heterogens: HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f06A (A:)
    snamvakqlsiflenksgrltevtevlakeninlsalciaenadfgilrgivsdpdkayk
    alkdnhfavnitdvvgiscpnvpgalakvlgflsaegvfieymysfannnvanvvirpsn
    mdkcievlkekkvdllaasdlykl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f06B (B:)
    snamvakqlsiflenksgrltevtevlakeninlsalciaenadfgilrgivsdpdkayk
    alkdnhfavnitdvvgiscpnvpgalakvlgflsaegvfieymysfannnvanvvirpsn
    mdkcievlkekkvdllaasdlykl