PDB entry 2f05

View 2f05 on RCSB PDB site
Description: Solution structure of free PAH2 domain of mSin3B
Class: transcription repressor
Keywords: 4 helix bundle, TRANSCRIPTION REPRESSOR
Deposited on 2005-11-11, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: paired amphipathic helix protein sin3b
    Species: Mus musculus [TaxId:10090]
    Gene: Sin3b, Kiaa0700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f05a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2f05A (A:)
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakrslftgngscemnsgqkneek

    Sequence, based on observed residues (ATOM records): (download) 
    >2f05A (A:)
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr