PDB entry 2ezz

View 2ezz on RCSB PDB site
Description: solution structure of human barrier-to-autointegration factor baf nmr, ensemble of 20 simulated annealing structures
Class: DNA-binding protein
Keywords: DNA-binding protein, integration, aids, retroviruses
Deposited on 1998-07-26, released 1999-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: barrier-to-autointegration factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75531 (0-88)
  Domains in SCOPe 2.05: d2ezza_
• Chain 'B':
  Compound: barrier-to-autointegration factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75531 (0-88)
  Domains in SCOPe 2.05: d2ezzb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ezzA (A:)
  mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
  ewlkdtcganakqsrdcfgclrewcdafl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ezzB (B:)
  mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
  ewlkdtcganakqsrdcfgclrewcdafl