PDB entry 2ezx
View 2ezx on RCSB PDB site
Description: solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure
Class: DNA-binding protein
Keywords: DNA-binding protein, integration, aids, retroviruses
Deposited on
1998-07-26, released
1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: barrier-to-autointegration factor
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2ezxa_ - Chain 'B':
Compound: barrier-to-autointegration factor
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2ezxb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2ezxA (A:)
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2ezxB (B:)
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl