PDB entry 2ezw

View 2ezw on RCSB PDB site
Description: Solution structure of the docking and dimerization domain of the type I alpha regulatory subunit of protein kinase A (RIalpha D/D)
Class: transferase
Keywords: regulatory subunit, anchoring, four-helix bundle, transferase
Deposited on 2005-11-10, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
  Species: Bos taurus [TaxId:9913]
  Gene: PRKAR1A (amino acids:12 - 61)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00514 (0-49)
  Domains in SCOPe 2.07: d2ezwa1
• Chain 'B':
  Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
  Species: Bos taurus [TaxId:9913]
  Gene: PRKAR1A (amino acids:12 - 61)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00514 (0-49)
  Domains in SCOPe 2.07: d2ezwb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ezwA (A:)
  slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ezwB (B:)
  slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak