PDB entry 2eza

View 2eza on RCSB PDB site
Description: amino terminal domain of enzyme I from escherichia coli, nmr, restrained regularized mean structure
Class: phosphotransferase
Keywords: phosphotransferase, transferase, kinase, sugar transport
Deposited on 1997-05-07, released 1997-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotransferase system, enzyme I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ezaa1, d2ezaa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ezaA (A:)
misgilaspgiafgkalllkedeividrkkisadqvdqeverflsgrakasaqletiktk
agetfgeekeaifeghimlledeeleqeiialikdkhmtadaaaheviegqasaleeldd
eylkeraadvrdigkrllrnilglkiidlsaiqdevilvaadltpsetaqlnlkkvlgfi
tdaggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmr
avqeqvasekaelaklkdr