PDB entry 2ez8

View 2ez8 on RCSB PDB site
Description: Pyruvate oxidase variant F479W in complex with reaction intermediate 2-lactyl-thiamin diphosphate
Class: oxidoreductase
Keywords: TPP enzyme, reaction intermediate
Deposited on 2005-11-10, released 2006-04-25
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.149
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum
    Gene: pox5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37063
      • engineered (478)
      • see remark 999 (560)
    Domains in SCOP 1.75: d2ez8a1, d2ez8a2, d2ez8a3
  • Chain 'B':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum
    Gene: pox5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37063
      • engineered (478)
      • see remark 999 (560)
    Domains in SCOP 1.75: d2ez8b1, d2ez8b2, d2ez8b3
  • Heterogens: MG, NA, TDL, FAD, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ez8A (A:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ez8A (A:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ez8B (B:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ez8B (B:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd