PDB entry 2ez6

View 2ez6 on RCSB PDB site
Description: Crystal structure of Aquifex aeolicus RNase III (D44N) complexed with product of double-stranded RNA processing
Class: hydrolase/RNA
Keywords: Ribonuclease III, dsRNA, RNA processing, RNA interference, HYDROLASE/RNA COMPLEX
Deposited on 2005-11-10, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rnc
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • engineered (43)
    Domains in SCOPe 2.07: d2ez6a1, d2ez6a2
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rnc
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • engineered (43)
    Domains in SCOPe 2.07: d2ez6b1, d2ez6b2
  • Chain 'C':
    Compound: 28-mer
  • Chain 'D':
    Compound: 28-mer
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ez6A (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgnalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ez6A (A:)
    mleqlekklgytfkdksllekalthvsyskkehyetleflgnalvnffivdllvqyspnk
    regflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsgr
    danftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhkk
    kfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ez6B (B:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgnalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ez6B (B:)
    mleqlekklgytfkdksllekalthvsyskkehyetleflgnalvnffivdllvqyspnk
    regflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsgr
    danftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhkk
    kfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.