PDB entry 2eyw

View 2eyw on RCSB PDB site
Description: N-terminal SH3 domain of CT10-Regulated Kinase
Class: signaling protein
Keywords: sh3, signaling protein
Deposited on 2005-11-10, released 2006-11-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2008-07-08, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v-crk sarcoma virus CT10 oncogene homolog isoform a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46108 (4-77)
      • expression tag (0-3)
    Domains in SCOPe 2.03: d2eywa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eywA (A:)
    gamgsgvilrqeeaeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrg
    mipvpyvekyrpasasvs