PDB entry 2eyw

View 2eyw on RCSB PDB site
Description: N-terminal SH3 domain of CT10-Regulated Kinase
Class: signaling protein
Keywords: sh3
Deposited on 2005-11-10, released 2006-11-10
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-05, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: v-crk sarcoma virus CT10 oncogene homolog isoform a
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46108 (4-77)
    • cloning artifact (0-3)
  Domains in SCOP 1.73: d2eywa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eywA (A:)
  gamgsgvilrqeeaeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrg
  mipvpyvekyrpasasvs