PDB entry 2eyq

View 2eyq on RCSB PDB site
Description: Crystal structure of Escherichia coli transcription-repair coupling factor
Class: hydrolase
Keywords: Mfd, SF2 ATPase
Deposited on 2005-11-09, released 2006-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.234
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription-repair coupling factor
    Species: Escherichia coli
    Gene: mfd
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eyqa1, d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqa6
  • Chain 'B':
    Compound: Transcription-repair coupling factor
    Species: Escherichia coli
    Gene: mfd
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eyqb1, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb5, d2eyqb6
  • Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eyqA (A:)
    gphmpeqyrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhd
    eisqftdqmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrv
    cphsflhghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgse
    lpyrldffddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfev
    krdpehiyqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqa
    dtlarfenrgvdpmrpllppqslwlrvdelfselknwprvqlktehlptkaananlgfqk
    lpdlavqaqqkapldalrkfletfdgpvvfsvesegrrealgellarikiapqrimrlde
    asdrgrylmigaaehgfvdtvrnlalicesdllgervarrrqdsrrtinpdtlirnlael
    higqpvvhlehgvgryagmttleaggitgeylmltyandaklyvpvsslhlisryaggae
    enaplhklggdawsrarqkaaekvrdvaaelldiyaqraakegfafkhdreqyqlfcdsf
    pfettpdqaqainavlsdmcqplamdrlvcgdvgfgktevamraaflavdnhkqvavlvp
    ttllaqqhydnfrdrfanwpvriemisrfrsakeqtqilaevaegkidiligthkllqsd
    vkfkdlgllivdeehrfgvrhkerikamranvdiltltatpiprtlnmamsgmrdlsiia
    tpparrlavktfvreydsmvvreailreilrggqvyylyndveniqkaaerlaelvpear
    iaighgqmrerelervmndfhhqrfnvlvcttiietgidiptantiiieradhfglaqlh
    qlrgrvgrshhqayawlltphpkamttdaqkrleaiasledlgagfalathdleirgage
    llgeeqsgsmetigfslymellenavdalkagrepsledltsqqtevelrmpsllpddfi
    pdvntrlsfykriasakteneleeikvelidrfgllpdpartlldiarlrqqaqklgirk
    legnekggviefaeknhvnpawligllqkqpqhyrldgptrlkfiqdlserktriewvrq
    fmreleenaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eyqA (A:)
    peqyrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhdeisq
    ftdqmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrvcphs
    flhghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgselpyr
    ldffddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfevkrdp
    ehiyqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqadtla
    rfenrgvdpmrpllppqslwlrvdelfselknwprvqlktehlptkaananlgfqklpdl
    avqaqqkapldalrkfletfdgpvvfsvesegrrealgellarikiapqrimrldeasdr
    grylmigaaehgfvdtvrnlalicesdllgervarrrqdsrrtinpdtlirnlaelhigq
    pvvhlehgvgryagmttleaggitgeylmltyandaklyvpvsslhlisryaggaeenap
    lhklggdawsrarqkaaekvrdvaaelldiyaqraakegfafkhdreqyqlfcdsfpfet
    tpdqaqainavlsdmcqplamdrlvcgdvgfgktevamraaflavdnhkqvavlvpttll
    aqqhydnfrdrfanwpvriemisrfrsakeqtqilaevaegkidiligthkllqsdvkfk
    dlgllivdeehrfgvrhkerikamranvdiltltatpiprtlnmamsgmrdlsiiatppa
    rrlavktfvreydsmvvreailreilrggqvyylyndveniqkaaerlaelvpeariaig
    hgqmrerelervmndfhhqrfnvlvcttiietgidiptantiiieradhfglaqlhqlrg
    rvgrshhqayawlltphpkamttdaqkrleaiasledlgagfalathdleirgagellge
    eqsgsmetigfslymellenavdalkagrepsledltsqqtevelrmpsllpddfipdvn
    trlsfykriasakteneleeikvelidrfgllpdpartlldiarlrqqaqklgirklegn
    ekggviefaeknhvnpawligllqkqpqhyrldgptrlkfiqdlserktriewvrqfmre
    leenai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eyqB (B:)
    gphmpeqyrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhd
    eisqftdqmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrv
    cphsflhghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgse
    lpyrldffddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfev
    krdpehiyqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqa
    dtlarfenrgvdpmrpllppqslwlrvdelfselknwprvqlktehlptkaananlgfqk
    lpdlavqaqqkapldalrkfletfdgpvvfsvesegrrealgellarikiapqrimrlde
    asdrgrylmigaaehgfvdtvrnlalicesdllgervarrrqdsrrtinpdtlirnlael
    higqpvvhlehgvgryagmttleaggitgeylmltyandaklyvpvsslhlisryaggae
    enaplhklggdawsrarqkaaekvrdvaaelldiyaqraakegfafkhdreqyqlfcdsf
    pfettpdqaqainavlsdmcqplamdrlvcgdvgfgktevamraaflavdnhkqvavlvp
    ttllaqqhydnfrdrfanwpvriemisrfrsakeqtqilaevaegkidiligthkllqsd
    vkfkdlgllivdeehrfgvrhkerikamranvdiltltatpiprtlnmamsgmrdlsiia
    tpparrlavktfvreydsmvvreailreilrggqvyylyndveniqkaaerlaelvpear
    iaighgqmrerelervmndfhhqrfnvlvcttiietgidiptantiiieradhfglaqlh
    qlrgrvgrshhqayawlltphpkamttdaqkrleaiasledlgagfalathdleirgage
    llgeeqsgsmetigfslymellenavdalkagrepsledltsqqtevelrmpsllpddfi
    pdvntrlsfykriasakteneleeikvelidrfgllpdpartlldiarlrqqaqklgirk
    legnekggviefaeknhvnpawligllqkqpqhyrldgptrlkfiqdlserktriewvrq
    fmreleenaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eyqB (B:)
    yrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhdeisqftd
    qmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrvcphsflh
    ghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgselpyrldf
    fddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfevkrdpehi
    yqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqadtlarfe
    nrgvdpmrpllppqslwlrvdelfselknwprvqlktehlptkaananlgfqklpdlavq
    aqqkapldalrkfletfdgpvvfsvesegrrealgellarikiapqrimrldeasdrgry
    lmigaaehgfvdtvrnlalicesdllgervarrrqdsrrtinpdtlirnlaelhigqpvv
    hlehgvgryagmttleaggitgeylmltyandaklyvpvsslhlisryaggaeenaplhk
    lggdawsrarqkaaekvrdvaaelldiyaqraakegfafkhdreqyqlfcdsfpfettpd
    qaqainavlsdmcqplamdrlvcgdvgfgktevamraaflavdnhkqvavlvpttllaqq
    hydnfrdrfanwpvriemisrfrsakeqtqilaevaegkidiligthkllqsdvkfkdlg
    llivdeehrfgvrhkerikamranvdiltltatpiprtlnmamsgmrdlsiiatpparrl
    avktfvreydsmvvreailreilrggqvyylyndveniqkaaerlaelvpeariaighgq
    mrerelervmndfhhqrfnvlvcttiietgidiptantiiieradhfglaqlhqlrgrvg
    rshhqayawlltphpkamttdaqkrleaiasledlgagfalathdleirgagellgeeqs
    gsmetigfslymellenavdalkagrepsledltsqqtevelrmpsllpddfipdvntrl
    sfykriasakteneleeikvelidrfgllpdpartlldiarlrqqaqklgirklegnekg
    gviefaeknhvnpawligllqkqpqhyrldgptrlkfiqdlserktriewvrqfmrelee
    nai