PDB entry 2ey4

View 2ey4 on RCSB PDB site
Description: Crystal Structure of a Cbf5-Nop10-Gar1 Complex
Class: isomerase/biosynthetic protein
Keywords: Trimeric complex, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2005-11-09, released 2006-01-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable tRNA pseudouridine synthase B
    Species: PYROCOCCUS FURIOSUS
    Gene: truB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ey4a1, d2ey4a2
  • Chain 'B':
    Compound: Probable tRNA pseudouridine synthase B
    Species: PYROCOCCUS FURIOSUS
    Gene: truB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ey4b1, d2ey4b2
  • Chain 'C':
    Compound: Small nucleolar rnp similar to gar1
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
    • GB AAL81915
    Domains in SCOP 1.73: d2ey4c1
  • Chain 'D':
    Compound: Small nucleolar rnp similar to gar1
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
    • GB AAL81915 (Start-81)
    Domains in SCOP 1.73: d2ey4d1
  • Chain 'E':
    Compound: Ribosome biogenesis protein Nop10
    Species: PYROCOCCUS FURIOSUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ey4e1
  • Chain 'F':
    Compound: Ribosome biogenesis protein Nop10
    Species: PYROCOCCUS FURIOSUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ey4f1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ey4A (A:)
    mardevrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptsh
    evvawikkilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdv
    pedkiiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyi
    rslihhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkai
    qpmekavehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalg
    kammtsqemlektkgiavdvekvfmprdwypkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ey4A (A:)
    evrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevva
    wikkilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedk
    iiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirsli
    hhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpme
    kavehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkamm
    tsqemlektkgiavdvekvfmprdwypkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ey4B (B:)
    mardevrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptsh
    evvawikkilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdv
    pedkiiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyi
    rslihhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkai
    qpmekavehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalg
    kammtsqemlektkgiavdvekvfmprdwypkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ey4B (B:)
    rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
    kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
    vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
    glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
    ehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsq
    emlektkgiavdvekvfmprdwypkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ey4C (C:)
    mekqgekmkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyv
    aikpkvsnpeiyvgevlyvder
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ey4C (C:)
    mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
    npeiyvgevlyvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ey4D (D:)
    mekqgekmkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyv
    aikpkvsnpeiyvgevlyvder
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ey4D (D:)
    mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
    npeiyvgevlyvder
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ey4E (E:)
    mrfrirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ey4E (E:)
    rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ey4F (F:)
    mrfrirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ey4F (F:)
    rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi