PDB entry 2ext

View 2ext on RCSB PDB site
Description: TRAP4 (engineered TRAP)
Class: RNA binding protein
Keywords: ARTIFICIAL, ENGINEERED, RING PROTEIN, 12-mer, RNA BINDING PROTEIN
Deposited on 2005-11-08, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2exta_
  • Chain 'B':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2extb_
  • Chain 'C':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2extc_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2extA (A:)
    ytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayi
    qtrhgviesegkkaaam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2extA (A:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2extB (B:)
    ytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayi
    qtrhgviesegkkaaam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2extB (B:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvies
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2extC (C:)
    ytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayi
    qtrhgviesegkkaaam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2extC (C:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvies