PDB entry 2exo

View 2exo on RCSB PDB site
Description: crystal structure of the catalytic domain of the beta-1,4-glycanase cex from cellulomonas fimi
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-07-11, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-1,4-beta-d-glycanase
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2exoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2exoA (A:)
    attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
    gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
    swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
    nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
    psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
    kkpayaavmeaf