PDB entry 2exl

View 2exl on RCSB PDB site
Description: GRP94 N-terminal Domain bound to geldanamycin
Class: chaperone
Keywords: GRP94, gp96, HSP90, Bergerat fold, Chaperone, Endoplasmic reticulum, Geldanamycin, 17-AAG
Deposited on 2005-11-08, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.3499999999999996 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2exla_
  • Chain 'B':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2exlb_
  • Heterogens: GDM, PG4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2exlA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exlA (A:)
    ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
    ltvkikcdkeknllhvtdtgvgmtreelvknlgtiastseligqfgvgfysaflvadkvi
    vtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtiknlvkk
    ysqfinfpiyvwssktktvwdwelmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2exlB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exlB (B:)
    sekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneel
    tvkikcdkeknllhvtdtgvgmtreelvknlgtistseligqfgvgfysaflvadkvivt
    skhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtiknlvkkys
    qfinfpiyvwssktktvwdwelmn