PDB entry 2exj

View 2exj on RCSB PDB site
Description: Structure of the family43 beta-Xylosidase D128G mutant from geobacillus stearothermophilus in complex with xylobiose
Class: hydrolase
Keywords: glykosidase, hydrolsase, xylosidase, family43, xylose, HYDROLASE
Deposited on 2005-11-08, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-D-xylosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68HB3 (Start-534)
      • engineered (127)
    Domains in SCOPe 2.07: d2exja1, d2exja2
  • Chain 'B':
    Compound: beta-D-xylosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68HB3 (Start-534)
      • engineered (127)
    Domains in SCOPe 2.07: d2exjb1, d2exjb2
  • Chain 'C':
    Compound: beta-D-xylosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68HB3 (Start-534)
      • engineered (127)
    Domains in SCOPe 2.07: d2exjc1, d2exjc2
  • Chain 'D':
    Compound: beta-D-xylosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68HB3 (Start-534)
      • engineered (127)
    Domains in SCOPe 2.07: d2exjd1, d2exjd2
  • Heterogens: XYS, CA, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2exjA (A:)
    makiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrls
    qlnmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpi
    ylnssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkg
    tdlritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyp
    rnplqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdg
    wpyvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkar
    pghlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwtt
    lqitwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdg
    mnwidlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exjA (A:)
    kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
    nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
    nssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
    lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
    plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
    yvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpg
    hlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlq
    itwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmn
    widlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2exjB (B:)
    makiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrls
    qlnmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpi
    ylnssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkg
    tdlritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyp
    rnplqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdg
    wpyvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkar
    pghlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwtt
    lqitwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdg
    mnwidlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exjB (B:)
    kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
    nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
    nssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
    lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
    plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
    yvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpg
    hlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlq
    itwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmn
    widlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2exjC (C:)
    makiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrls
    qlnmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpi
    ylnssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkg
    tdlritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyp
    rnplqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdg
    wpyvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkar
    pghlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwtt
    lqitwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdg
    mnwidlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exjC (C:)
    kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
    nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
    nssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
    lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
    plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
    yvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpg
    hlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlq
    itwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmn
    widlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2exjD (D:)
    makiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrls
    qlnmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpi
    ylnssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkg
    tdlritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyp
    rnplqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdg
    wpyvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkar
    pghlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwtt
    lqitwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdg
    mnwidlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exjD (D:)
    kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
    nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
    nssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
    lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
    plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
    yvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpg
    hlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlq
    itwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmn
    widlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel