PDB entry 2exf

View 2exf on RCSB PDB site
Description: Solution structure of the HIV-1 nucleocapsid (NCp7(12-55)) complexed with the DNA (-) Primer Binding Site
Class: Viral Protein/DNA
Keywords: protein-DNA complex, stem-loop, bulge, zinc-finger, Viral Protein/DNA COMPLEX
Deposited on 2005-11-08, released 2007-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nucleocapsid protein* (NC*)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03368 (1-43)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d2exfa1, d2exfa2
• Chain 'B':
  Compound: 5'-d(*gp*tp*cp*cp*cp*tp*gp*tp*tp*cp*gp*gp*gp*c)-3'
  Species: synthetic, synthetic
  
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2exfA (A:)
  nvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterqan
  

  
  
• Chain 'B':
  No sequence available.