PDB entry 2exd

View 2exd on RCSB PDB site
Description: The solution structure of the C-terminal domain of a nfeD homolog from Pyrococcus horikoshii
Class: membrane protein
Keywords: nfeD, MEMBRANE PROTEIN
Deposited on 2005-11-08, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nfeD short homolog
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0471
    Database cross-references and differences (RAF-indexed):
    • GB NP_142450 (0-71)
      • cloning artifact (72-73)
    Domains in SCOPe 2.07: d2exda1, d2exda2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2exdA (A:)
    rrettdigggkytfelkgkvgkvvkiaedhylvevegdkwiaysdeklslgdrvmvvdvd
    glklkvkrippqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exdA (A:)
    rrettdigggkytfelkgkvgkvvkiaedhylvevegdkwiaysdeklslgdrvmvvdvd
    glklkvkrippqle