PDB entry 2exc

View 2exc on RCSB PDB site
Description: Inhibitor complex of JNK3
Class: transferase
Keywords: enzyme-inhibitor complex, kinase inhibitor, transferase
Deposited on 2005-11-08, released 2006-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2excx_
  • Heterogens: JNK, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2excX (X:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyv
    vtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcp
    efmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidp
    akrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2excX (X:)
    dnqfysvevgdstftvlkryqnlkpigsgivcaaydavldrnvaikklsrpfqnqthakr
    ayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldherms
    yllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglavtryyrapevilgmgy
    kenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyven
    rpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyin
    vwydpaeveapppqlderehtieewkeliykevmn