PDB entry 2ex9

View 2ex9 on RCSB PDB site
Description: Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, complexed with penicillin-V
Class: hydrolase
Keywords: penicillin-binding protein, penicillin-V, cephem, penem, D-alanyl-D-alanine-carboxypeptidase, D-alanyl-D-alanine-endopeptidase
Deposited on 2005-11-08, released 2006-06-13
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.207
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein 4
    Species: Escherichia coli
    Gene: dacb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24228 (Start-457)
      • see remark 999 (241)
    Domains in SCOP 1.75: d2ex9a1
  • Heterogens: PNV, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ex9A (A:)
    manvdeyitqlpaganlalmvqkvgasapaidyhsqqmalpastqkvitalaaliqlgpd
    frftttletkgnvengvlkgdlvarfgadptlkrqdirnmvatlkksgvnqidgnvlidt
    sifashdkapgwpwndmtqcfsappaaaivdrncfsvslysapkpgdmafirvasyypvt
    mfsqvrtlprgsaeaqyceldvvpgdlnrftltgclpqrseplplafavqdgasyagail
    kyelkqagitwsgtllrqtqvnepgtvvaskqsaplhdllkimlkksdnmiadtvfrmig
    harfnvpgtwragsdavrqilrqqagvdigntiiadgsglsrhnliapatmmqvlqyiaq
    hdnelnfismlplagydgslqyraglhqagvdgkvsaktgslqgvynlagfittasgqrm
    afvqylsgyavepadqrnrriplvrfesrlykdiyqnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ex9A (A:)
    tqlpaganlalmvqkvgasapaidyhsqqmalpastqkvitalaaliqlgpdfrftttle
    tkgnvengvlkgdlvarfgadptlkrqdirnmvatlkksgvnqidgnvlidtsifashdk
    apgwpwndmtqcfsappaaaivdrncfsvslysapkpgdmafirvasyypvtmfsqvrtl
    prgsaeaqyceldvvpgdlnrftltgclpqrseplplafavqdgasyagailkyelkqag
    itwsgtllrqtqvnepgtvvaskqsaplhdllkimlkksdnmiadtvfrmigharfnvpg
    twragsdavrqilrqqagvdigntiiadgsglsrhnliapatmmqvlqyiaqhdnelnfi
    smlplagydgslqyraglhqagvdgkvsaktgslqgvynlagfittasgqrmafvqylsg
    yaveiplvrfesrlykdiyqnn