PDB entry 2ewu

View 2ewu on RCSB PDB site
Description: The F20H mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F
Class: electron transport
Keywords: electron transport
Deposited on 2005-11-07, released 2006-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.114
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00132 (0-106)
    • engineered (19)
  Domains in SCOPe 2.08: d2ewua_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ewuA (A:)
  apkapadglkmdktkqpvvhnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
  sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs