PDB entry 2ewo

View 2ewo on RCSB PDB site
Description: X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6.
Class: hydrolase
Keywords: Q8DW17, SmR6, X-Ray, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2005-11-04, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.235
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewoa1, d2ewoa2
  • Chain 'B':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewob2, d2ewob3
  • Chain 'C':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewoc2, d2ewoc3
  • Chain 'D':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewod2, d2ewod3
  • Chain 'E':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewoe2, d2ewoe3
  • Chain 'F':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewof2, d2ewof3
  • Chain 'G':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewog2, d2ewog3
  • Chain 'H':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewoh2, d2ewoh3
  • Chain 'I':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewoi2, d2ewoi3
  • Chain 'J':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewoj2, d2ewoj3
  • Chain 'K':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewok2, d2ewok3
  • Chain 'L':
    Compound: Putative agmatine deiminase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: aguA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW17 (Start-368)
      • modified residue (16)
      • modified residue (28)
      • modified residue (90)
      • modified residue (177)
      • modified residue (273)
      • modified residue (302)
      • modified residue (337)
      • cloning artifact (369)
    Domains in SCOPe 2.07: d2ewol2, d2ewol3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ewoA (A:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoA (A:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ewoB (B:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoB (B:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ewoC (C:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoC (C:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ewoD (D:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoD (D:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ewoE (E:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoE (E:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ewoF (F:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoF (F:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ewoG (G:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoG (G:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ewoH (H:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoH (H:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipreeg
    emaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihc
    itqqqpatl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ewoI (I:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoI (I:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ewoJ (J:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoJ (J:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ewoK (K:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoK (K:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ewoL (L:)
    makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefe
    pvslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwef
    nawgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcl
    lhpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciyt
    ddkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipree
    gemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnih
    citqqqpatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewoL (L:)
    akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
    vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
    awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
    hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
    dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
    lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
    tl