PDB entry 2ewn

View 2ewn on RCSB PDB site
Description: Ecoli Biotin Repressor with co-repressor analog
Class: Ligase, TRANSCRIPTION
Keywords: helix-turn-helix, disorder-to-order transition, biotin, Ligase, TRANSCRIPTION
Deposited on 2005-11-04, released 2006-02-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BirA BIFUNCTIONAL PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: birA, bioR, dhbB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ewna1, d2ewna2, d2ewna3
  • Chain 'B':
    Compound: BirA BIFUNCTIONAL PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: birA, bioR, dhbB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ewnb1, d2ewnb2, d2ewnb3
  • Heterogens: BTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ewnA (A:)
    mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
    pepiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrg
    rkwfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylq
    drklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaa
    mlirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgalll
    eqdgiikpwmggeislrsaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewnA (A:)
    dntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpe
    piqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrk
    wfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdr
    klagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaaml
    irelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgallleq
    dgiikpwmggeislrsae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ewnB (B:)
    mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
    pepiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrg
    rkwfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylq
    drklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaa
    mlirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgalll
    eqdgiikpwmggeislrsaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewnB (B:)
    kdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslp
    epiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgr
    kwfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqd
    rklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaam
    lirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgallle
    qdgiikpwmggeislrs