PDB entry 2ewm

View 2ewm on RCSB PDB site
Description: Crystal Structure of the (S)-Specific 1-Phenylethanol Dehydrogenase of the Denitrifying Bacterium Strain EbN1
Class: transferase
Keywords: Dehydrogenase, Transferase
Deposited on 2005-11-04, released 2006-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (S)-1-Phenylethanol dehydrogenase
    Species: Azoarcus [TaxId:12960]
    Database cross-references and differences (RAF-indexed):
    • GB YP_158329 (Start-248)
    Domains in SCOPe 2.08: d2ewma1
  • Chain 'B':
    Compound: (S)-1-Phenylethanol dehydrogenase
    Species: Azoarcus [TaxId:12960]
    Database cross-references and differences (RAF-indexed):
    • GB YP_158329 (Start-248)
    Domains in SCOPe 2.08: d2ewmb1
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ewmA (A:)
    mtqrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvk
    cdvsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflm
    akafvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvn
    aiapslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtl
    avdggmvrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewmA (A:)
    tqrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkc
    dvsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflma
    kafvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvna
    iapslvrtattlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ewmB (B:)
    mtqrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvk
    cdvsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflm
    akafvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvn
    aiapslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtl
    avdggmvrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewmB (B:)
    qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
    vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
    afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
    apslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtlav
    dggmvrh