PDB entry 2ewl

View 2ewl on RCSB PDB site
Description: Solution structure of the C-terminal domain (monomer) of the HPV45 oncoprotein E7
Class: oncoprotein, virus/viral protein
Keywords: e7, hpv, oncoprotein, zinc binding
Deposited on 2005-11-04, released 2006-10-17
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-24, with a file datestamp of 2007-07-20.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein E7
  Species: Human papillomavirus
  Gene: E7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21736 (4-55)
    • cloning artifact (0-3)
  Domains in SCOP 1.75: d2ewla1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ewlA (A:)
  gshmaepqrhkilcvcckcdgrieltvessaedlrtlqqlflstlsfvcpwcatnq