PDB entry 2ewk

View 2ewk on RCSB PDB site
Description: The T24V mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F
Class: electron transport
Keywords: Electron transport
Deposited on 2005-11-03, released 2006-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.112
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00132 (0-106)
      • engineered (23)
    Domains in SCOPe 2.07: d2ewka_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ewkA (A:)
    apkapadglkmdktkqpvvfnhsvhkavkcgdchhpvngkedyqkcatagchdnmdkkdk
    sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs