PDB entry 2ewi

View 2ewi on RCSB PDB site
Description: The F20Y mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F
Class: electron transport
Keywords: electron transport
Deposited on 2005-11-03, released 2006-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.115
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00132 (0-106)
      • engineered (19)
    Domains in SCOPe 2.07: d2ewia_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ewiA (A:)
    apkapadglkmdktkqpvvynhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
    sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs