PDB entry 2ewd

View 2ewd on RCSB PDB site
Description: Crystal structure of the Lactate Dehydrogenase from Cryptosporidium parvum complexed with substrate (Pyruvic acid) and cofactor analog (3-Acetylpyridine adenine dinucleotide).
Class: Oxidoreductase
Keywords: PROTEIN-SUBSTRATE_COFACTOR ANALOG COMPLEX, Oxidoreductase
Deposited on 2005-11-02, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase,
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB XP_628238 (0-316)
      • see remark 999 (46)
      • see remark 999 (165)
    Domains in SCOPe 2.07: d2ewda3, d2ewda4
  • Chain 'B':
    Compound: lactate dehydrogenase,
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB XP_628238 (0-316)
      • see remark 999 (46)
      • see remark 999 (165)
    Domains in SCOPe 2.07: d2ewdb3, d2ewdb4
  • Heterogens: A3D, PYR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ewdA (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtddyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ewdB (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtddyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap