PDB entry 2ewc

View 2ewc on RCSB PDB site
Description: Structure of hypothetical protein from Streptococcus pyogenes M1 GAS, member of highly conserved yjgF family of proteins
Class: structural genomics, unknown function
Keywords: yjgF proteins family, conserved hypothetical protein, COG0251, Putative translation initiation inhibitor, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-11-02, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewca1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4 (0-End)
      • modified residue (0)
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewcb_
  • Chain 'C':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewcc_
  • Chain 'D':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewcd_
  • Chain 'E':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewce_
  • Chain 'F':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4 (0-End)
      • modified residue (0)
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewcf_
  • Chain 'G':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewcg_
  • Chain 'H':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewch_
  • Chain 'I':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewci_
  • Chain 'J':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewcj_
  • Chain 'K':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewck_
  • Chain 'L':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi|13623057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XS4
      • modified residue (48)
      • modified residue (65)
      • modified residue (78)
      • modified residue (81)
    Domains in SCOPe 2.07: d2ewcl_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ewcA (A:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcA (A:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ewcB (B:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcB (B:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    kh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ewcC (C:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcC (C:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ewcD (D:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcD (D:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvaysk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ewcE (E:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcE (E:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ewcF (F:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcF (F:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    kh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ewcG (G:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcG (G:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ewcH (H:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcH (H:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ewcI (I:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcI (I:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ewcJ (J:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcJ (J:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ewcK (K:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcK (K:)
    ktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltld
    avvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvaysk
    h
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ewcL (L:)
    mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltl
    davvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvays
    khismt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewcL (L:)
    tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
    vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh