PDB entry 2ew9

View 2ew9 on RCSB PDB site
Description: Solution structure of apoWLN5-6
Class: hydrolase
Keywords: copper trafficking, ferrodoxin-like fold, Structural Genomics, Structural Proteomics in Europe, SPINE, HYDROLASE
Deposited on 2005-11-02, released 2006-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting ATPase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7B, PWD, WC1, WND
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35670 (1-148)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d2ew9a1, d2ew9a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ew9A (A:)
mapqkcflqikgmtcascvsniernlqkeagvlsvlvalmagkaeikydpeviqpleiaq
fiqdlgfeaavmedyagsdgnieltitgmtcascvhnieskltrtngityasvalatska
lvkfdpeiigprdiikiieeigfhaslaq