PDB entry 2ew8

View 2ew8 on RCSB PDB site
Description: Crystal Structure of the (S)-Specific 1-Phenylethanol Dehydrogenase of the Denitrifying Bacterium Strain EbN1
Class: transferase
Keywords: Dehydrogenase, TRANSFERASE
Deposited on 2005-11-02, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (S)-1-Phenylethanol dehydrogenase
    Species: Azoarcus sp. EbN1 [TaxId:76114]
    Database cross-references and differences (RAF-indexed):
    • GB YP_158329 (Start-248)
    Domains in SCOPe 2.07: d2ew8a1
  • Chain 'B':
    Compound: (S)-1-Phenylethanol dehydrogenase
    Species: Azoarcus sp. EbN1 [TaxId:76114]
    Database cross-references and differences (RAF-indexed):
    • GB YP_158329 (Start-248)
    Domains in SCOPe 2.07: d2ew8b_
  • Chain 'C':
    Compound: (S)-1-Phenylethanol dehydrogenase
    Species: Azoarcus sp. EbN1 [TaxId:76114]
    Database cross-references and differences (RAF-indexed):
    • GB YP_158329 (Start-248)
    Domains in SCOPe 2.07: d2ew8c_
  • Chain 'D':
    Compound: (S)-1-Phenylethanol dehydrogenase
    Species: Azoarcus sp. EbN1 [TaxId:76114]
    Database cross-references and differences (RAF-indexed):
    • GB YP_158329 (Start-248)
    Domains in SCOPe 2.07: d2ew8d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ew8A (A:)
    mtqrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvk
    cdvsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflm
    akafvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvn
    aiapslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtl
    avdggmvrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ew8A (A:)
    qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
    vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
    afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
    apslvnmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ew8B (B:)
    mtqrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvk
    cdvsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflm
    akafvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvn
    aiapslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtl
    avdggmvrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ew8B (B:)
    qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
    vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
    afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
    apslvmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ew8C (C:)
    mtqrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvk
    cdvsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflm
    akafvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvn
    aiapslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtl
    avdggmvrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ew8C (C:)
    qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
    vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
    afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
    apslvmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ew8D (D:)
    mtqrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvk
    cdvsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflm
    akafvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvn
    aiapslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtl
    avdggmvrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ew8D (D:)
    qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
    vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
    afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
    apslvnmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh