PDB entry 2ew3

View 2ew3 on RCSB PDB site
Description: Solution Structure Of The SH3 Domain Of Human SH3GL3
Class: signaling protein
Keywords: SH3, SH3GL3, Solution structure, NMR, SIGNALING PROTEIN
Deposited on 2005-11-02, released 2006-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3-containing GRB2-like protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ew3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ew3A (A:)
    mdqpccrglydfepenqgelgfkegdiitltnqidenwyegmihgesgffpinyvevivp
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ew3A (A:)
    mdqpccrglydfepenqgelgfkegdiitltnqidenwyegmihgesgffpinyvevivp