PDB entry 2ew1

View 2ew1 on RCSB PDB site
Description: Crystal Structure of Rab30 in complex with a GTP analogue
Class: signaling protein
Keywords: G-protein, RAB, GTP analogue, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2005-11-01, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-30
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ew1a1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ew1A (A:)
    mgsshhhhhhssglvprgsmedydflfkivlignagvgktclvrrftqglfppgqgatig
    vdfmiktveingekvklqiwdtagqerfrsitqsyyrsanaliltyditceesfrclpew
    lreieqyasnkvitvlvgnkidlaerrevsqqraeefseaqdmyyletsakesdnveklf
    ldlacrlisearqntlvnnvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ew1A (A:)
    dydflfkivlignagvgktclvrrftqglfppgqgatigvdfmiktveingekvklqiwd
    tagqerfrsitqsyyrsanaliltyditceesfrclpewlreieqyasnkvitvlvgnki
    dlaerrevsqqraeefseaqdmyyletsakesdnveklfldlacrlisear