PDB entry 2evx

View 2evx on RCSB PDB site
Description: Crystal structure of pumpkin seed globulin
Class: plant protein
Keywords: cucubitin, pumpkin seed storage globulin, PLANT PROTEIN
Deposited on 2005-11-01, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 11S globulin beta subunit
    Species: Cucurbita maxima [TaxId:3661]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13744
      • see remark 999 (45)
      • see remark 999 (293)
    Domains in SCOPe 2.07: d2evxa1, d2evxa2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2evxA (A:)
    qieqqspwefqgsevwqqhryqspracrlenlraqdpvrraeaeagftevwdqdndefqc
    agvnmirhtirpkglllpgfsnapklifvaqgfgirgiaipgcaetyqtdlrrsqsagsa
    fkdqhqkirpfregdllvvpagvshwmynrgqsdlvlivfadtrnvanqidpylrkfyla
    grpeqvergveewerssrkgssgeksgnifsgfadefleeafqidgglvrklkgedderd
    rivqvdedfevllpekdeeersrgryiesesesengleetictlrlkqnigrseradvfn
    prggristanyhtlpilrqvrlsaergvlysnamvaphytvnshsvmyatrgnarvqvvd
    nfgqsvfdgevregqvlmipqnfvvikrasdrgfewiafktndnaitnllagrvsqmrml
    plgvlsnmyrisreeaqrlkygqqemrvlspgrsqgrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2evxA (A:)
    acrlenlraqdpvrraeaeagftevwdqdndefqcagvnmirhtirpkglllpgfsnapk
    lifvaqgfgirgiaipgcaetyqtdlrfkdqhqkirpfregdllvvpagvshwmynrgqs
    dlvlivfadtrnvanqidpylrkfylagrpeqvergveksgnifsgfadefleeafqidg
    glvrklkgedderdrivqvdedfevlletictlrlkqnigrseradvfnprggristany
    htlpilrqvrlsaergvlysnamvaphytvnshsvmyatrgnarvqvvdnfgqsvfdgev
    regqvlmipqnfvvikrasdrgfewiafktndnaitnllagrvsqmrmlplgvlsnmyri
    sreeaqrlkygqqemrvlspgr