PDB entry 2evr

View 2evr on RCSB PDB site
Description: crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.60 a resolution
Class: hydrolase
Keywords: putative gamma-d-glutamyl-l-diamino acid endopeptidase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, hydrolase
Deposited on 2005-10-31, released 2005-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.159
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COG0791: Cell wall-associated hydrolases (invasion-associated proteins)
    Species: Nostoc punctiforme [TaxId:63737]
    Gene: 53686717
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2evra1, d2evra2
  • Heterogens: CL, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2evrA (A:)
    mgsdkihhhhhhmvrlseaevqnpklgeyqcladlnlfdspectrlatqsasgrhlwvts
    nhqnlavevylceddypgwlslsdfdslqpatvpyqaatfseseikkllaeviaftqkam
    qqsnyylwggtvgpnydcsglmqaafasvgiwlprdayqqegftqpitiaelvagdlvff
    gtsqkathvglyladgyyihssgkdqgrdgigidilseqgdavslsyyqqlrgagrvfks
    yepqrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2evrA (A:)
    klgeyqcladlnlfdspectrlatqsasgrhlwvtsnhqnlavevylceddypgwlslsd
    fdslqpatvpyqaatfseseikkllaeviaftqkamqqsnyylwggtvgpnydcsglmqa
    afasvgiwlprdayqqegftqpitiaelvagdlvffgtsqkathvglyladgyyihssgk
    dqgrdgigidilseqgdavslsyyqqlrgagrvfksyepqrr