PDB entry 2eve

View 2eve on RCSB PDB site
Description: X-Ray Crystal Structure of Protein PSPTO5229 from Pseudomonas syringae. Northeast Structural Genomics Consortium Target PsR62
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-10-31, released 2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PSPTO5229
    Species: Pseudomonas syringae group genomosp. 3 [TaxId:223283]
    Gene: 1186914
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UR7 (Start-148)
      • modified residue (5)
      • modified residue (40)
      • modified residue (134)
      • cloning artifact (149)
    Domains in SCOPe 2.08: d2evea1, d2evea2
  • Heterogens: MPO, EDO, 144, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2eveA (A:)
maywlmksepdefsisdlqrlgkarwdgvrnyqarnflrtmaegdefffyhsscpepgia
gigkivktaypdptaldpdshyhdakatteknpwsaldigfvdifknvlglgylkqqsql
eqlplvqkgsrlsvmpvtaeqwaailalrlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2eveA (A:)
aywlmksepdefsisdlqrlgkarwdgvrnyqarnflrtmaegdefffyhsscpepgiag
igkivktaypdptaldpdshyhdakatteknpwsaldigfvdifknvlglgylkqqsqle
qlplvqkgsrlsvmpvtaeqwaailalrl