PDB entry 2evd

View 2evd on RCSB PDB site
Description: Crystal structure of human Glycolipid Transfer Protein complexed with 12:0 Lactosylceramide
Class: lipid transport
Keywords: protein-glycolipid complex
Deposited on 2005-10-31, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2evda1
  • Heterogens: LAT, SPH, DAO, OCT, D10, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2evdA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2evdA (A:)
    laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
    pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
    irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalsqnvteeeclekirlflv
    nytatidviyemytqmnaelnykv