PDB entry 2ev6

View 2ev6 on RCSB PDB site
Description: Bacillus subtilis manganese transport regulator (MNTR) bound to zinc
Class: transcription
Keywords: helix-turn-helix, DNA-binding protein, metalloregulatory protein
Deposited on 2005-10-31, released 2006-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.233
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis
    Gene: mntR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • see remark 999 (80)
    Domains in SCOP 1.73: d2ev6a1, d2ev6a2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis
    Gene: mntR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • see remark 999 (80)
    Domains in SCOP 1.73: d2ev6b1, d2ev6b2
  • Heterogens: ZN, FLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ev6A (A:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ev6A (A:)
    psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvlt
    skgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeed
    darkkdlksiqkkteh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ev6B (B:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ev6B (B:)
    psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvlt
    skgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeed
    darkkdlksiqkktehh