PDB entry 2eux

View 2eux on RCSB PDB site
Description: Structure of a Ndt80-DNA complex (MSE VARIANT vA4G)
Class: cell cycle/DNA
Keywords: beta-barrel, ig-fold transcription factor, cell cycle/DNA complex
Deposited on 2005-10-30, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.173
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NDT80 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NDT80
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38830
      • engineered (150)
      • engineered (204)
    Domains in SCOPe 2.08: d2euxa_
  • Chain 'B':
    Compound: 5'-d(*tp*gp*cp*gp*ap*cp*gp*cp*ap*ap*ap*ap*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*gp*tp*tp*tp*tp*tp*gp*cp*gp*tp*cp*gp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2euxA (A:)
    gplgsmnementdpvlqddlvskyerelsteqeedtpviltqlnedgttsnyfdkrklki
    aprstlqfkvgppfelvrdycpvveshtgrtldlriipridrgfdhideewvgykrnyft
    lvstfetancdldtflkssfdllvedssvegrlrvqyfaikikaknddddteinlvqhta
    krdkgpqfcpsvcplvpsplpkhqtireasnvrnitkmkkydstfylhrdhvnyeeygvd
    sllfsypedsiqkvaryervqfassisvkkpsqqnkhfslhvilgavvdpdtfhgenpgi
    pydelalkngskgmfvylqemktppliirgrspsnyassqritvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2euxA (A:)
    viltqlnedgttsnyfdkrklkiaprstlqfkvgppfelvrdycpvveshtgrtldlrii
    pridrgfdhideewvgykrnyftlvstfetancdldtflkssfdllvgrlrvqyfaikik
    aknddddteinlvqhtakrdkgpqfcpsvcplvpsplpkhqtireasnvrnitkmkkyds
    tfylhrdhvnyeeygvdsllfsypedsiqkvaryervqfassisvkkpsqqnkhfslhvi
    lgavvdpdgipydelalkngskgmfvylqemktppliirgrspsnyassq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.