PDB entry 2euq

View 2euq on RCSB PDB site
Description: Cytochrome c peroxydase (CCP) in complex with 3-thienylmethylamine
Class: Oxidoreductase
Keywords: engineered ligand binding site, Oxidoreductase
Deposited on 2005-10-29, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.147
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (3-293)
      • expression tag (2)
      • engineered (190)
    Domains in SCOPe 2.07: d2euqa2, d2euqa3
  • Heterogens: HEM, BVC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2euqA (A:)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2euqA (A:)
    tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
    tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
    kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
    knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
    kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl