PDB entry 2eum

View 2eum on RCSB PDB site
Description: Crystal structure of human Glycolipid Transfer Protein complexed with 8:0 Lactosylceramide
Class: lipid transport
Keywords: Protein-glycolipid complex, LIPID TRANSPORT
Deposited on 2005-10-28, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2euma_
  • Heterogens: LAT, SPH, OCA, OCT, D10, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eumA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eumA (A:)
    laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
    pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
    irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskqnvteeeclekirlfl
    vnytatidviyemytqmnaelnykv