PDB entry 2eul

View 2eul on RCSB PDB site
Description: Structure of the transcription factor Gfh1.
Class: transcription
Keywords: Gfh1, transcription factor, RNA polymerase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSCRIPTION
Deposited on 2005-10-28, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: gfhI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eula1, d2eula2
  • Chain 'B':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: gfhI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eulb1, d2eulb2
  • Chain 'C':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: gfhI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eulc1, d2eulc2
  • Chain 'D':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: gfhI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2euld1, d2euld2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eulA (A:)
    marevkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekariea
    ridsledilsravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkis
    daspmgkallghrvgdvlsldtpkgrrefrvvaihg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eulB (B:)
    marevkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekariea
    ridsledilsravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkis
    daspmgkallghrvgdvlsldtpkgrrefrvvaihg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eulC (C:)
    marevkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekariea
    ridsledilsravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkis
    daspmgkallghrvgdvlsldtpkgrrefrvvaihg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eulD (D:)
    marevkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekariea
    ridsledilsravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkis
    daspmgkallghrvgdvlsldtpkgrrefrvvaihg