PDB entry 2euk

View 2euk on RCSB PDB site
Description: Crystal Structure of Human Glycolipid Transfer Protein complexed with 24:1 Galactosylceramide
Class: lipid transport
Keywords: Protein-glycolipid complex
Deposited on 2005-10-28, released 2006-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.181
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2euka1
  • Heterogens: GAL, SPH, NER, OCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eukA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eukA (A:)
    laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
    pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
    irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalsqnvteeeclekirlflv
    nytatidviyemytqmnaelnykv