PDB entry 2eui

View 2eui on RCSB PDB site
Description: Crystal structure of a probable acetyltransferase
Class: structural genomics, unknown function
Keywords: transferase, dimer, T1065, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2005-10-28, released 2005-12-06
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable acetyltransferase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HX01 (0-152)
      • modified residue (0)
      • modified residue (26)
      • modified residue (105)
      • modified residue (114)
    Domains in SCOP 1.73: d2euia1
  • Chain 'B':
    Compound: Probable acetyltransferase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HX01 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (105)
      • modified residue (114)
    Domains in SCOP 1.73: d2euib1
  • Chain 'D':
    Compound: Probable acetyltransferase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HX01 (0-152)
      • modified residue (0)
      • modified residue (26)
      • modified residue (105)
      • modified residue (114)
    Domains in SCOP 1.73: d2euid1
  • Chain 'E':
    Compound: Probable acetyltransferase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HX01 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (105)
      • modified residue (114)
    Domains in SCOP 1.73: d2euie1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2euiA (A:)
    mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
    lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
    vdnevaqkvyesigfredqefknytlpisdels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2euiB (B:)
    mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
    lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
    vdnevaqkvyesigfredqefknytlpisdels
    

    Sequence, based on observed residues (ATOM records): (download)
    >2euiB (B:)
    mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladrllgf
    cqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvstsvne
    vaqkvyesigfredqefknytlpisd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2euiD (D:)
    mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
    lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
    vdnevaqkvyesigfredqefknytlpisdels
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2euiE (E:)
    mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
    lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
    vdnevaqkvyesigfredqefknytlpisdels
    

    Sequence, based on observed residues (ATOM records): (download)
    >2euiE (E:)
    mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
    lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
    vdnevaqkvyesigfredqefknytlpisde