PDB entry 2eug

View 2eug on RCSB PDB site
Description:
Deposited on 1998-10-13, released 1999-10-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-13, with a file datestamp of 1999-10-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2euga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eugA (A:)
    ltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    aphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese